SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004052 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004052
Domain Number 1 Region: 123-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.22e-146
Family Myotubularin-like phosphatases 0.0000000224
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-17
Family GRAM domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004052   Gene: ENSBTAG00000003116   Transcript: ENSBTAT00000004052
Sequence length 610
Comment pep:known_by_projection chromosome:UMD3.1:12:34177965:34197920:1 gene:ENSBTAG00000003116 transcript:ENSBTAT00000004052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDAHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDAE
RLRGWELIDLAEEYKRMGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQSKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPANRYMYVMDTR
PRLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYS
GLESSGWLRHIKAVMDAAIFLAKAIAAESASVLVHCSDGWDRTSQVCSLGSLLLDPYYRT
IRGFMVLIEKDWISFGHKFSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFNEA
FLLQIHEHIHSCQFGNFIGNCQKEREELKLKEKTYSLWPFLLDDQKKYLNPLYSSQSQKS
AVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESAGLLL
VGSQSVRPESPALKATLSLKEQALLPVNNVLRTIEGSSPADNRYSEYADEFSKAEPAVVS
LEYGVARMTC
Download sequence
Identical sequences E1BJH8
ENSBTAP00000004052 ENSBTAP00000004052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]