SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004152 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004152
Domain Number 1 Region: 338-561
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.81e-75
Family ATP sulfurylase catalytic domain 0.00000000644
Further Details:      
 
Domain Number 2 Region: 168-335
Classification Level Classification E-value
Superfamily PUA domain-like 9.94e-53
Family ATP sulfurylase N-terminal domain 0.000000529
Further Details:      
 
Domain Number 3 Region: 1-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-33
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.00000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004152   Gene: ENSBTAG00000003196   Transcript: ENSBTAT00000004152
Sequence length 568
Comment pep:known chromosome:UMD3.1:26:9365644:9402403:1 gene:ENSBTAG00000003196 transcript:ENSBTAT00000004152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNIRQGLNKNLGFSTWDREENIRRIAEVA
KLFADAGLVCITSFISPFAKDRENARKIHESSGLPFFEIFVDAPLNICERRDVKGLYKRA
RAGEIKGFTGIDSDYEKPESPELVLKTNLSSVSDCMQQVVELLQEQNIVPHTVIKGIHEL
FVPENKLDQVRAEAEALPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVVHFGTLI
DDGVINMSIPIVLPISADDKTRLEGCSKFVLTHGGRRVAILEDPEFYEHRKEERCSHVWG
TTCAKHPYIKMVMESGDWLVGGDLQVLERIQWNDGLDQYRLTPLELKQKCKEMDADAVFA
FQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLE
EEVLDPKSTIVAIFPSPMLYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETKRDLY
EPTHGGKVLTMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPERHDEFDFISGTRMRKLARE
GENPPDGFMAPKAWKVLTDYYASLEKNN
Download sequence
Identical sequences F1N085
ENSBTAP00000004152 ENSBTAP00000004152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]