SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004211 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004211
Domain Number 1 Region: 521-762
Classification Level Classification E-value
Superfamily Ras GEF 4.18e-38
Family Ras GEF 0.012
Further Details:      
 
Domain Number 2 Region: 139-257
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-26
Family SH2 domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004211   Gene: ENSBTAG00000003245   Transcript: ENSBTAT00000004211
Sequence length 826
Comment pep:known chromosome:UMD3.1:3:49943443:50069722:1 gene:ENSBTAG00000003245 transcript:ENSBTAT00000004211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLVERRADAYQDVSIHGTLPRKKKGPPP
IRSCDNFSHVGTLPHSRSPRHHSPLIQDVIQEQPLQDWKGEAFTFRDQHLLDPTLEYVKF
SKERHVMDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLMQRDGDFLVRDSL
SSPGDFVLTCQWKNLPQHFKIRRTVVRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
ISQQSGAIIFQPVNRTVPLRCLEERYGASSPDRAHEGSLTEGRPDAAKRLSLTVGGTQAR
EQGLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGGKLTPQSPSVGTSP
CPNSPVFRTGSEPTLSPAVVRRVSSDARPGEALRGSDSQLCPKPPPKPCKAPLLKAPPSP
SIWLNSEANYCELNPALAASYDGASRLPFCAQDSYVELLTAKQNGGLGTRNSDTSYLILD
DDDRTRPWKPPPAPGDTVGEDQDTFVMPLLETTSSFKPNDFESKLLPPENKPLETSMLKR
AKELFTNSDPKVIAQHLLSVDCKVARILEVSEEMRKNMGVNSGLELITLPYGHQLRLDII
ERHNTMAIGIAVDILGCTGSLEDRAATLNKIIQVAVELKDSMGDLYSFSAIMKALEMPQI
TRLEKTWTALRHQYTQTAILYEKQLKPFSKVLHEGRESTCVPPNNVSVPLLMPLVTLMER
EAVTFEGTDMWEKNDESCEIMLNHLATARLMAEAADSYRMNAEKILAGFQPDEEMSEVFK
TEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQMEF
Download sequence
Identical sequences A0A140T848
ENSBTAP00000004211 XP_005204326.1.76553 XP_005204327.1.76553 XP_010801601.1.76553 ENSBTAP00000004211 ENSBTAP00000055991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]