SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004499 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004499
Domain Number 1 Region: 103-211
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 4.18e-35
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 6.8e-22
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00023
Further Details:      
 
Domain Number 3 Region: 228-278
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.74e-17
Family Transcriptional factor domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004499   Gene: ENSBTAG00000003460   Transcript: ENSBTAT00000004499
Sequence length 280
Comment pep:known chromosome:UMD3.1:14:23620858:23637730:-1 gene:ENSBTAG00000003460 transcript:ENSBTAT00000004499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPS
TDKDSEEKKKDTAVTSQNSPEAREESSSSGNMSSRKDETNARDTYVSSFPRAPSTSDSVR
LKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDA
KNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLF
TCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
Download sequence
Identical sequences F1MIT2
ENSBTAP00000004499 ENSBTAP00000004499 9913.ENSBTAP00000004499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]