SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004527 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004527
Domain Number 1 Region: 17-192
Classification Level Classification E-value
Superfamily Nudix 2.92e-28
Family MutT-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004527   Gene: ENSBTAG00000003483   Transcript: ENSBTAT00000004527
Sequence length 323
Comment pep:known_by_projection chromosome:UMD3.1:8:69922731:69925053:-1 gene:ENSBTAG00000003483 transcript:ENSBTAT00000004527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGLRGALTAVLGGRGLLVQNYDSGPAGEPPAPVRLRRNVCYVVLAVFLNEQDEVLLV
QEAKKECRGSWYLPAGRMEPGETIVEALQREVKEEAGLQCEPLTLLSVEERGPSWIRFAF
LTRPTGGILKTSKEADAESLQAGWYPRTSLPTPLRAQDILHLVDLAAQYRQRARHPLLLP
QELPCSLVCQRLVATFTNVQTVWVLVGTVGTPHLPVTACGFTPMEQRGGIKMAVLRLLQE
CLSLHHLAVETQGLLGLQHLGKDLTDGICMNVLVTVAFRNPGLQNEPPKVRGENFFWWKV
VEEDLQNQLLQRLRDSSVVPINR
Download sequence
Identical sequences F1N0N5
ENSBTAP00000004527 XP_002689812.1.76553 XP_015320075.1.59421 ENSBTAP00000004527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]