SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004536 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004536
Domain Number 1 Region: 185-455
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.7e-66
Family Mitochondrial carrier 0.00025
Further Details:      
 
Domain Number 2 Region: 8-160
Classification Level Classification E-value
Superfamily EF-hand 1.2e-32
Family Calmodulin-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004536   Gene: ENSBTAG00000003491   Transcript: ENSBTAT00000004536
Sequence length 462
Comment pep:known_by_projection chromosome:UMD3.1:7:19235826:19258805:1 gene:ENSBTAG00000003491 transcript:ENSBTAT00000004536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGPGEAERRQRWGRLFEELDSNKDGRVDIRELRQGLARLGGGDPDRGAQQGISPEGDT
DPDGGLDLEEFILYLQEREQRLLLLFHSLDRNQDGQIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSEQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMIQEGGVHS
LWRGNGINVLKIAPESAIKFMAYEQVGADMGSAGLAWERGNVFGPLGVGIGSPMGCPQQV
LKTRLTLRRTGQYKGLLDCAWQILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNR
WLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQDTVEGSNPTMCGVFR
RILAQQGWPGLYRGMTPTLLKVLPAGGISYVVYEAMKKTLGV
Download sequence
Identical sequences F1MW58
ENSBTAP00000004536 ENSBTAP00000004536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]