SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004556 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004556
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily EF-hand 1.22e-35
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 89-185
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-28
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004556   Gene: ENSBTAG00000003502   Transcript: ENSBTAT00000004556
Sequence length 243
Comment pep:known chromosome:UMD3.1:7:49961405:49995991:-1 gene:ENSBTAG00000003502 transcript:ENSBTAT00000004556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACTDKELRNLASRLKDWFGALHEDANRVINPTSSETAQGRFDTSILPICKDSLGWMFNKL
DMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNE
MNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVNC
EEEQETSGDFGSGGSVVLLDDLEDEQDLGPKDRLGKPRVHARAVTEDDEDEDDDKEDEVG
YIW
Download sequence
Identical sequences F1MVT9
ENSBTAP00000004556 ENSBTAP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]