SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004648 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004648
Domain Number 1 Region: 372-623
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-86
Family Eukaryotic proteases 0.0000000209
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000004648
Domain Number - Region: 130-154
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000175
Family Pan module (APPLE domain) 0.026
Further Details:      
 
Domain Number - Region: 33-64
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Pan module (APPLE domain) 0.051
Further Details:      
 
Domain Number - Region: 299-335
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0131
Family Pan module (APPLE domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004648   Gene: ENSBTAG00000003572   Transcript: ENSBTAT00000004648
Sequence length 625
Comment pep:known chromosome:UMD3.1:27:15350931:15370080:1 gene:ENSBTAG00000003572 transcript:ENSBTAT00000004648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLYQMVHFALFASVAGECVTTLFQDACFKGGDITVAFAPNAKHCQIICTHHPRCLLFT
FMTESSSEDPTKWYTCILKDSVTETLPMVNMTGAISGYSSKQCLHHISACSKDMYVDLNM
KGMNYNSSLAQSARECQQRCTDDTHCHFFTFATRHFPSIKDRNTCLLKNTQTGTPTSITK
LHEVVSGFSLKSCGLSNLACIRDIFPRTAFVDITIDTVMAPDPFVCRSICTHHPSCLFFT
FLSEEWPTASERNLCLLKTSSSGLPSARFRKNRAFSGFSLQHCQHSVPVFCHSSFYRNTD
FLGEELDIVDADSHEACQKTCTNSIRCQFFTYSPSQESCNGGKGKCYLKLSANGSPTKIL
HGTGSISGYTLRLCKMDNVCTTKIKTRIVGGTQSVHGEWPWQITLHVTSPTQRHLCGGAI
IGNQWILTAAHCFNEVKSPNVLRVYSGILNQSEIKEDTSFFGVQEIIIHDQYEKAESGYD
IALLKLETAMNYTDSQWPICLPSKGDRNVMYTECWVTGWGYRKLRDKIQNTLQKAKVPLM
TNEECQAGYREHRITSKMVCAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCG
QRERPGVYSNVVEYLDWILEKTQGP
Download sequence
Identical sequences F1MUT4
9913.ENSBTAP00000004648 ENSBTAP00000004648 ENSBTAP00000004648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]