SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004690 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004690
Domain Number 1 Region: 38-385
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.83e-130
Family Calpain large subunit, catalytic domain (domain II) 0.00000000183
Further Details:      
 
Domain Number 2 Region: 392-549
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.18e-55
Family Calpain large subunit, middle domain (domain III) 0.00000217
Further Details:      
 
Domain Number 3 Region: 564-739
Classification Level Classification E-value
Superfamily EF-hand 4.75e-41
Family Penta-EF-hand proteins 0.0000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004690   Gene: ENSBTAG00000021066   Transcript: ENSBTAT00000004690
Sequence length 741
Comment pep:known_by_projection chromosome:UMD3.1:23:17807298:17820479:1 gene:ENSBTAG00000021066 transcript:ENSBTAT00000004690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLHAPPDPRPEVASSHISHASGKASASPSPETVFDRGIAARISQNRLKAKGMGQHHNAQN
YNNQSFEELRALCLRRGELFEDPFFPAEPTSLGFKELAPNSKHVQNISWQRPSQITSNPQ
FIVNGVSPTDICQGVLGDCWLLAAIGSLTAYPKLLSRVVPKGQSFKKNYAGIFHFQIWQF
GEWMDVVVDDRLPTKNGKLVFVHSAERTEFWSALLEKAYAKLNGSYEALSGGNTVEGFED
FTGGVTQSFQLQNPPRNLQRILRKAVERSSLMGALCVLQVTHEHELESLTQGMLVRGHAY
SVTGLQDVSYQGRTETLIRVRNPWGRIEWNGAWSDNAKEWEEVAPDVQRQLLHRKEDGEF
WMSYQDFLGNFTLLEICNVIPDTLSGDYKSCWHTTFYEGSWRRGSTAGGCRSYLDTFWTN
PQFKICLPEKDDDIEDDEAVCTCLVALMQKNWRRTRPHGAQLETIGFVIYSIPKEFQNLQ
DVHLKKDFFVKYQDLGFSEIFTNSREVSSQFQLPPGEYIIIPSTFEPHKDADFLLRVFTE
KHSESWELDEANYAELLQEESISETDIDQDFVRLFHIVAGGEGKEIGMYELQKLLNKVVS
RFKNFKTKGFSLDVCRCMVNLLDKDGSGKLGLREFQVLWRKIKKWTDIFRECDQDQSGTL
NSYEMRLAVEKAGIKLNNKVTQVLVARYANDSLIMEFDSFISCFLRLKAMFKTAYFLTMD
PENTGQISLDLNQWLQITMWG
Download sequence
Identical sequences F1MXQ5
ENSBTAP00000004690 ENSBTAP00000004690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]