SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004732 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004732
Domain Number 1 Region: 29-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.92e-50
Family Eukaryotic proteases 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004732   Gene: ENSBTAG00000003628   Transcript: ENSBTAT00000004732
Sequence length 242
Comment pep:known chromosome:UMD3.1:4:106332950:106339086:-1 gene:ENSBTAG00000003628 transcript:ENSBTAT00000004732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLILLWALLNLPVALTFDPNYKDDITPPYLIYLKSDYLPCVGVLIHPLWVITAANCNLP
RLQLILGVTKPSNIDEEKYVQVVGYEKMIHHPQFSITSIEHNLMLIKLQTHIELNNYVKI
VSLPKEPAAEDDTCIVSTWAYNLCDHYKDPDSLQNVNISVISKVECLKAYKYMHIRDSMM
CVGIVPGRRQPCKEVTAAPAVCNGILQGILTFADGCVLRADVGIYTRIINYIPWIENTIQ
NN
Download sequence
Identical sequences Q32LI2
ENSBTAP00000004732 NP_001035599.1.59421 NP_001035599.1.76553 ENSBTAP00000004732 9913.ENSBTAP00000004732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]