SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004737 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004737
Domain Number 1 Region: 24-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.22e-117
Family Eukaryotic proteases 0.000000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004737   Gene: ENSBTAG00000003633   Transcript: ENSBTAT00000004737
Sequence length 246
Comment pep:known chromosome:UMD3.1:4:106358115:106362513:-1 gene:ENSBTAG00000003633 transcript:ENSBTAT00000004737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Download sequence
Identical sequences P00760
NP_001107199.1.59421 NP_001107199.1.76553 XP_002687054.3.76553 XP_871686.4.59421 ENSBTAP00000004737 ENSBTAP00000033392 9913.ENSBTAP00000004737 ENSBTAP00000004737 ENSBTAP00000033392 4gux_A 4gux_B 4gux_C 4xoj_A 5fxl_A 5jyi_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]