SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004885 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004885
Domain Number 1 Region: 192-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.59e-82
Family Mitochondrial carrier 0.0000322
Further Details:      
 
Domain Number 2 Region: 11-186
Classification Level Classification E-value
Superfamily EF-hand 1.58e-39
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004885   Gene: ENSBTAG00000003752   Transcript: ENSBTAT00000004885
Sequence length 477
Comment pep:known chromosome:UMD3.1:3:35152469:35210446:1 gene:ENSBTAG00000003752 transcript:ENSBTAT00000004885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFVLPTAACQDVEPPTRYETLFQKLDRNGDGVVDISELQEGLKSLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQILGL
TISEQQAELILQSIDADGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSAKMNIYGGFQQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFVSGSMAGA
TAQTFIYPMEVLKTRLAVGKTGQYSGMFDCAKKILKYEGMGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSHWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMIE
KSPQLNMVGLFRRILSKEGLPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences A5PJZ1
ENSBTAP00000004885 NP_001092536.1.59421 NP_001092536.1.76553 XP_005891397.1.15283 XP_010829244.1.44457 XP_019812515.1.53367 ENSBTAP00000004885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]