SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004899 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000004899
Domain Number - Region: 126-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0902
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004899   Gene: ENSBTAG00000003766   Transcript: ENSBTAT00000004899
Sequence length 214
Comment pep:known chromosome:UMD3.1:6:118023637:118025125:1 gene:ENSBTAG00000003766 transcript:ENSBTAT00000004899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDFPPSCGPVAEEEAEAQVAAWSGDSGNVSQSHSSASGPWEDEGPESGAPSRDPPLLRR
AAAGYASCLLPGAGARPEIEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVGEGVPLIYA
KATEMRRVYSKIDRLEAFVGMVSASVARLEEQVARAEAELGTFPSTFRKLLHTINVPSFF
HKAPSSRSQLTGYEPPVVFRTEDHFPCCSERPQV
Download sequence
Identical sequences Q0VCC3
ENSBTAP00000004899 NP_001074200.1.59421 NP_001074200.1.76553 9913.ENSBTAP00000004899 ENSBTAP00000004899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]