SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004963 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004963
Domain Number 1 Region: 17-138
Classification Level Classification E-value
Superfamily EF-hand 5.05e-24
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004963   Gene: ENSBTAG00000003810   Transcript: ENSBTAT00000004963
Sequence length 145
Comment pep:known chromosome:UMD3.1:4:9730410:9748324:-1 gene:ENSBTAG00000003810 transcript:ENSBTAT00000004963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQKVLKRLVESISKSVNSFKKSEIECLIRIFHNVVGRGDVKLANVGLDRNTFRVILHSI
FGMTDDVLMNRVFFAFDKDNDNYINVKEWVKGLSVFLRGTFEEKLKFCFEVYYFNGDGYI
SRERIYDMLKNSLHQQSPGEETDEE
Download sequence
Identical sequences Q32KM4
NP_001035635.1.59421 NP_001035635.1.76553 ENSBTAP00000004963 ENSBTAP00000004963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]