SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005119 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005119
Domain Number 1 Region: 284-593
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-116
Family Transglutaminase core 0.0000000151
Further Details:      
 
Domain Number 2 Region: 135-283
Classification Level Classification E-value
Superfamily E set domains 6.65e-45
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 719-818
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 
Domain Number 4 Region: 607-718
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-27
Family Transglutaminase, two C-terminal domains 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005119   Gene: ENSBTAG00000003920   Transcript: ENSBTAT00000005119
Sequence length 846
Comment pep:known_by_projection chromosome:UMD3.1:10:20735503:20750260:1 gene:ENSBTAG00000003920 transcript:ENSBTAT00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
TEDDDWGPERHGDRGGRGSGSRNRRPDSRGSDSRQPGSRDSRRPGSRDSRRPGSRDSRRP
GSRGSAVNAAGDGTIREGMLVVTGVDLLSSRSDQNRREHHTDEFEYDELILRRGQPFQMV
LFLSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVH
TSPNAIIGKFQFTIRTRCEAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLN
ESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVN
SLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRC
LGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPS
GFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDD
GSFKIVYVEEKAIGSLIITKAIGSNMREDITHTYKHPEGSEAERKAVETAAAHGSKPNVY
ATRDSAEDVAVQVEAQDAVMGQDLMVSVVLTNRGSSLRTVKLHLYLSVTFYTGVAGSVFK
ESKKEVVLAPGASERVTMPVAYKEYRVHLVDQGAMLLNISGHVKENGQVLAKQHTFRLRT
PDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGGAFSDIRGSGRSGETIPM
ASRGGA
Download sequence
Identical sequences F1MBB7
9913.ENSBTAP00000005119 ENSBTAP00000005119 ENSBTAP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]