SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005323 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005323
Domain Number 1 Region: 79-272
Classification Level Classification E-value
Superfamily Nudix 6.5e-41
Family IPP isomerase-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005323   Gene: ENSBTAG00000004075   Transcript: ENSBTAT00000005323
Sequence length 287
Comment pep:known chromosome:UMD3.1:13:46682710:46685834:1 gene:ENSBTAG00000004075 transcript:ENSBTAT00000005323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRALAPARAIGRAASGGGARIGGGARALGRSLKDTPPAVQPTVDGSCLRFPGRRGGWAA
MPEVSTDDLDERQVQLMAEMCILVDENDRRIGAETKKNCHLNENIERGLLHRAFSVFLFN
TENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPSELEENDAIGVRRAAQRRLKAELGIPM
EEVPPEEINYLTRIHYKAQSDSIWGEHEIDYILLVKKNVTLNPDPNEIKSYCYVTKEELE
ELIGKAAHGEIKITPWFQIIADTFLFKWWDNLNRLNLFVDHEKIHRM
Download sequence
Identical sequences A0A140T853
ENSBTAP00000005323 NP_001069127.1.59421 NP_001069127.1.76553 9913.ENSBTAP00000005323 ENSBTAP00000005323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]