SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005452 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005452
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.52e-53
Family Globins 0.000000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005452   Gene: ENSBTAG00000039178   Transcript: ENSBTAT00000005452
Sequence length 147
Comment pep:known chromosome:UMD3.1:15:49007001:49008553:1 gene:ENSBTAG00000039178 transcript:ENSBTAT00000005452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTTEEKAAVASLWAKVNVEVVGGESLARLLIVYPWTQRFFDSFGNLYSESAIMGNPK
VKAHGRKVLNSFGNAIEHMDDLKGTFADLSELHCDKLHVDPENFRLLGNMILIVLATHFS
KEFTPQMQASWQKLTNAVANALAHKYH
Download sequence
Identical sequences P06643
ENSBTAP00000005452 ENSBTAP00000005452 NP_001014910.1.59421 NP_001014910.1.76553 XP_019831430.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]