SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005477 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005477
Domain Number 1 Region: 265-394,529-789
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.83e-33
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 708-939
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 1.15e-16
Family Putative isomerase YbhE 0.016
Further Details:      
 
Domain Number 3 Region: 995-1115
Classification Level Classification E-value
Superfamily EF-hand 0.000000005
Family Calmodulin-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005477   Gene: ENSBTAG00000004187   Transcript: ENSBTAT00000005477
Sequence length 1164
Comment pep:known_by_projection chromosome:UMD3.1:17:55596059:55669832:-1 gene:ENSBTAG00000004187 transcript:ENSBTAT00000005477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEENPLEETEEYGEIEMQEEDDEEEEYPNFEGLENVQKELKEVNTLAWIESPEEEEE
EEGEEEGREFGEEVEAENGEEGEEAVKEEVGEDTAEALEEEEEASGAQEESTVEPEEITT
SIISLERFTQPDSQTVLSEISLVKKSGSESKLSLQSEFLETFELPRSPGSQLEFLDLDVT
TSGEPLISFPERQPSGELDQRPQDELEEEEGRDLEPERGDLEQEKSKKSEKESQPKARIT
KASLVSTATEDILFQRRESANMYPLTMTWSFGWNSSLPVYYLRENQRVLLYASGHTGVIY
NVLKNNQYHLQGHPNVISCLCISEDRRWVATADKGPDCLIIIWDSFTGIPVHTIFDSCPR
DNGIRAMAMTRDAKYLATISDAEIQKVCIWKWTLAVETPACTLDLPKEYGFQNFILKNYN
NNKELVSNSKTQVIYYTWYPEGGILVHSAPLLTEKTFNKLVGKFSQSVFHLNLTQILSAT
MEGKLVVWDIYRPLPSASSSMGFPHIKPCKLVHLQKEGITVLTTVDSYIVTGDIRGNIKF
YDHTLSIVNWYSHFKLSSIRSLSFSKTPAAPPAENTNYPPDCTLKSDDFVVRNFIIGTSD
ASVYHLTVDGTKLEKLFVEPRDAICAISCHPYQPLIAIGSFCGMIKVWDYEQKKYLFSRV
FEKGLGVQSLTYNPEGALLGAGFTEGTVYILDAMSLESAISEPFRYSRSSVTHISFSHDS
QYMATADVSFTVAVYVVRVKHRRRVWEYLARLRSHRKSIRSILFGVHLDSNEPRLLSLGR
DRLLIEYNLLKSYKDHLAVLDIHRTDQGSYPTCMVWYPPLTKELFLLICNSGYKVKLFNS
TTKMCRKTLLGPVYGSPIEQIQILPVKSTLELQKRYVVFINRDKVGLQILPVDGNPHKTS
ALICHPNGVAGMALSYDGCCAFTAGGQDRSVVQWEINLSALEAAVSLGGEDLTPFYGLVS
GGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEGEIED
MFNEIRFSEYVDTGKLTDKINLPDFFKVYLNHRPPFGNTMSGIQQSFDILGFTNSKGEKA
IQREDFLNLLHTKGEHMTEEEMTDCFATLFGLNPEGWKSEPAASSVKGSEICLEEELPDE
ITAEIFTTEILGLTISQDSGQDPR
Download sequence
Identical sequences E1BJ01
ENSBTAP00000005477 ENSBTAP00000005477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]