SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005550 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005550
Domain Number 1 Region: 25-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-75
Family Eukaryotic proteases 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005550   Gene: ENSBTAG00000031447   Transcript: ENSBTAT00000005550
Sequence length 316
Comment pep:known_by_projection chromosome:UMD3.1:22:53296646:53304315:1 gene:ENSBTAG00000031447 transcript:ENSBTAT00000005550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLSRLSAGLAASRPLGLSRSFLLLVLLLLNSGYKGDSTKPACGQPWWPKNLDLSRHW
PWEVSLRVGNEHVCGGALIDLKWVVTAAHCIQGTKEYSVILGTSKLKPPNSTRTLLIPVR
DIIMHPKYWGRTFIMGDVALLQLYNPVIISKYVQPICLPEPNYSLKVGTQCWVTGWGQVK
QRFSANSTLASELQEAEVFIMDNKKCDQIYRKKSHIPRVVPLVLGDMICATNYREDLCSG
DSGGPLACEVEGRWILAGVLSWEKACAKVRNPGVYTRITKYSRWIKKQISNGILSVPCTS
AWLLLLFWLLQPQMGP
Download sequence
Identical sequences F1MSR1
ENSBTAP00000005550 9913.ENSBTAP00000005550 XP_019839839.1.53367 ENSBTAP00000005550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]