SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005749 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005749
Domain Number 1 Region: 317-569
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.82e-87
Family STAT DNA-binding domain 0.000000765
Further Details:      
 
Domain Number 2 Region: 140-316
Classification Level Classification E-value
Superfamily STAT 5.1e-43
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 570-688
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-37
Family SH2 domain 0.0000451
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.23e-28
Family Transcription factor STAT-4 N-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005749   Gene: ENSBTAG00000004380   Transcript: ENSBTAT00000005749
Sequence length 859
Comment pep:known_by_projection chromosome:UMD3.1:5:57318819:57333404:1 gene:ENSBTAG00000004380 transcript:ENSBTAT00000005749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSPFQDQLHELYSNSLLPMDVRQHLAVWIEDQNWQKAALGNDAAMANMLF
LHFLDQLNSECGRCSQDSEYFLLQHNLRKFYRDIQALPTGSTQLAEMIFNLLLEEKRILT
WAQRAQLEQREPAPEAPGESQQHELDSRILKLQAMKEKLVKSISQLKDQQDVFCFRYNIE
KSVRTPSLDPRQTRQMDILQETLNELDRQRKEVLDASKALLGQLTTLIELLLPKLEEWKV
QQQKACIGAPPVGGLEQLEKWFTDGAKLLFHLRQLLKELKELSHMVSYDGDPLNKGVDLR
EAQVTELLQRLLHRAFVVENQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSVDRDSPKSQGNSFRKFNILTSNQKTLTPEKGQTQGLIWDFGYLTLVEQRSGGSGKGNN
KGLLSVTEELHIISFTVKYTYQGLKQELTTDSLPVVIISNMNQLSIAWASVLWFNLLSSN
PQDQQFFSNPPKAPWNLLGPALSWQFSSYVNRGLDSDQLGMLRDKLFGHNSRTEGASLSW
VDFIKRESPPGKLPFWTWLDKILDLIHDHLKDLWKDGRIMGFVSRNQVRRLLKKTVSGTF
LLRFSETLEGGITCSWVEHQDDDEVLINSVQPFTKEVLQSLPLTKIISQYQMLTEENIPE
NPLRFLYPRIPRDEAFGCYSQEKINPEERKKYLKHKLIFVSNRQVDELQQLPELKLEPEL
ESLELGLGFTSGPEHGPGLDLEPLLEAGLDLSMEPMLEPTLEPTLGEVSQGVLEPHPGPQ
LQLEPIPELELQPMPEPDLPYDLRHLNTEDMEIFRNSMRIEEIMPNGDPVLPCQNTMDEA
DIFNPSHFYADGPLSPSDY
Download sequence
Identical sequences E1B8Z4
ENSBTAP00000005749 9913.ENSBTAP00000005749 ENSBTAP00000005749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]