SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005753 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005753
Domain Number 1 Region: 83-184
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 177-222
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005753   Gene: ENSBTAG00000004386   Transcript: ENSBTAT00000005753
Sequence length 223
Comment pep:known chromosome:UMD3.1:25:9975299:9975970:-1 gene:ENSBTAG00000004386 transcript:ENSBTAT00000005753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAISTAAEPRRRPESSSSSSSSSSSTSSPSSAAPARLRPCPAAAAPAPAP
APGDTHFRTFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQ
RNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQ
RRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences F1MSN0
ENSBTAP00000005753 XP_002698010.1.76553 XP_869409.1.59421 ENSBTAP00000005753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]