SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006033 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006033
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-44
Family Calponin-homology domain, CH-domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006033   Gene: ENSBTAG00000004599   Transcript: ENSBTAT00000006033
Sequence length 199
Comment pep:known chromosome:UMD3.1:1:57178554:57192433:1 gene:ENSBTAG00000004599 transcript:ENSBTAT00000006033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences A0A1S3G590 A0A1U7UFX4 A0A286XD14 A0A2I2U6L4 F6ZBC3 G5B1E2 L8I664 Q3ZBY2
HGL_H00000391160 ENSCPOP00000016464 ENSBTAP00000006033 ENSOCUP00000003445 ENSBTAP00000006033 ENSECAP00000007857 ENSCPOP00000016464 NP_001029671.1.59421 NP_001029671.1.76553 XP_001503205.3.31192 XP_002716756.3.1745 XP_003469248.3.53824 XP_004391667.1.74151 XP_004593262.1.84141 XP_004624759.1.9945 XP_004675278.1.23501 XP_004675279.1.23501 XP_004835797.1.39548 XP_004835798.1.39548 XP_004835799.1.39548 XP_005201360.1.76553 XP_005902293.1.15283 XP_005982344.1.78601 XP_005982345.1.78601 XP_005982346.1.78601 XP_005982347.1.78601 XP_005982348.1.78601 XP_006046615.1.26621 XP_006046616.1.26621 XP_006741000.1.47382 XP_007945616.1.48129 XP_007945617.1.48129 XP_008064776.1.4292 XP_008590339.1.73410 XP_010799396.1.76553 XP_010851042.1.44457 XP_010851043.1.44457 XP_011284262.2.62641 XP_012784684.1.84141 XP_012883988.1.60039 XP_012930860.1.39548 XP_014335761.1.15283 XP_014717807.1.49734 XP_014717808.1.49734 XP_015400473.1.5354 XP_019303872.1.44245 XP_019834288.1.53367 XP_019834362.1.53367 XP_019834444.1.53367 XP_020011827.1.5219 10141.ENSCPOP00000016464 9796.ENSECAP00000007857 9913.ENSBTAP00000006033 9986.ENSOCUP00000003445 ENSECAP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]