SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006260 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006260
Domain Number 1 Region: 345-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-70
Family Protein kinases, catalytic subunit 0.000000000277
Further Details:      
 
Domain Number 2 Region: 6-132
Classification Level Classification E-value
Superfamily SH2 domain 1.2e-31
Family SH2 domain 0.000000244
Further Details:      
 
Domain Number 3 Region: 158-255,333-360
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-30
Family SH2 domain 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006260   Gene: ENSBTAG00000004767   Transcript: ENSBTAT00000006260
Sequence length 605
Comment pep:known chromosome:UMD3.1:8:88423429:88529462:-1 gene:ENSBTAG00000004767 transcript:ENSBTAT00000006260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGANNLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHDRKAHHYT
IERELNGTYAITGGRAHGSPAELCHYHTQELDGLVCLLKKPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRAKDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKIGGQSGNINFRPQLPSSHPGTRTSSGNQVDSSTTFNPYEPDRGPW
ANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYY
QMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEM
AELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECNFVHRDLAARNVLLVTQHYAKI
SDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQ
KPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCWTYDVENRPGFVAVELRLRNYY
YDVVN
Download sequence
Identical sequences Q32PK0
NP_001032542.1.59421 NP_001032542.1.76553 XP_005887258.1.15283 XP_010834252.1.44457 ENSBTAP00000006260 ENSBTAP00000006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]