SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006283 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006283
Domain Number 1 Region: 128-278
Classification Level Classification E-value
Superfamily EF-hand 4.39e-38
Family Calmodulin-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006283   Gene: ENSBTAG00000004785   Transcript: ENSBTAT00000006283
Sequence length 279
Comment pep:known chromosome:UMD3.1:29:45988625:45992117:1 gene:ENSBTAG00000004785 transcript:ENSBTAT00000006283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQGRGRHGPDPAPRPQKPPVEVLASSSGAEGPPLMRKRSSKREKGLRGSRKGPSSSG
EQTPMQGPEAPGSSKNPSRTREGQEGPIPSASGLAPRRQSHRHRPGPQHDAAQRMYGPLL
NRIFGKDRELGPEELDELQAAFEEFDTDHDGYIGYRDLGECMRTLGYMPTEMELIEVSQH
VKMRMGGRVDFEEFVEMMGPKLREETAHMLGLRELRIAFREFDRDRDGRITVAELREAAP
ALLGEPLVGPELEEMLQEVDLNGDGTVDFNEFVMMLSRH
Download sequence
Identical sequences Q8HZJ4
ENSBTAP00000006283 9913.ENSBTAP00000006283 ENSBTAP00000006283 NP_776681.1.59421 NP_776681.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]