SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006432 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006432
Domain Number 1 Region: 141-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-122
Family Transglutaminase core 0.0000000000717
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily E set domains 1.47e-42
Family Transglutaminase N-terminal domain 0.00000901
Further Details:      
 
Domain Number 3 Region: 480-592
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.41e-30
Family Transglutaminase, two C-terminal domains 0.00000203
Further Details:      
 
Domain Number 4 Region: 592-690
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-26
Family Transglutaminase, two C-terminal domains 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006432   Gene: ENSBTAG00000001785   Transcript: ENSBTAT00000006432
Sequence length 691
Comment pep:known chromosome:UMD3.1:13:53261635:53304213:-1 gene:ENSBTAG00000001785 transcript:ENSBTAT00000006432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLQSVDWQIASNRQAHHTERFYGKDLLVRRGQLFQVSLTLSQGLSSGGRVTFTASTGP
YPSESANTKAVFPLSNGTSSSGWGAQLVSSRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSTLKLGTFILLFNPWLQADSVFMSNHAEREEYVQEDAGIIFVGSTNRISMIGWNYGQF
EEGILNICLSVLDNSLNFRRDPATDVAHRNDPKYVGRVLSAMINGNDDSGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDQNLSVDVYYDPLGRPMDKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESNGALKKNSADTHSVGKY
ISTKAVGSNSRMDVTEKYKYPEGSSQERQVFEKALRKLKPTMSFSATSASSLAREEREPS
ISGRFKVAGVLTVGKEVNLILMLKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKIAYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDIILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
Download sequence
Identical sequences F1MIC8
ENSBTAP00000006432 ENSBTAP00000006432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]