SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006645 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006645
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily EF-hand 2.09e-28
Family Calmodulin-like 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006645   Gene: ENSBTAG00000005041   Transcript: ENSBTAT00000006645
Sequence length 185
Comment pep:known chromosome:UMD3.1:11:72920571:72971981:1 gene:ENSBTAG00000005041 transcript:ENSBTAT00000006645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDSFLKLCPPGKYYKEATLTVDQVSSLPA
LRVNPFRDRICRVFSHNNVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQRIILRLLNSDDMSEDLLTDLTSHVLNESDLDNDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
Download sequence
Identical sequences A0A023T1Z1 C7A278 F1MQC6 L8IMQ3
9913.ENSBTAP00000006645 ENSBTAP00000006645 ENSBTAP00000006645 NP_001069923.2.59421 NP_001069923.2.76553 NP_001158185.1.54773 NP_001158185.1.66739 XP_005686987.1.57651 XP_005895766.1.15283 XP_010838899.1.44457 XP_019826136.1.53367 XP_020769524.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]