SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006659 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006659
Domain Number 1 Region: 224-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-76
Family Protein kinases, catalytic subunit 0.00000000286
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily SH2 domain 8.06e-36
Family SH2 domain 0.00000291
Further Details:      
 
Domain Number 3 Region: 54-139
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-20
Family SH3-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006659   Gene: ENSBTAG00000005049   Transcript: ENSBTAT00000006659
Sequence length 501
Comment pep:known chromosome:UMD3.1:8:7658877:7710709:-1 gene:ENSBTAG00000005049 transcript:ENSBTAT00000006659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKRQVKEKGRSGWSPVKTSTQSKEPPPLPSLVVFNHLTPPPPDTTHPDQENHFVV
ALYDYKAMNDRDLQMLKGEKLQILKETGDWWLAKSLITGREGYVPSNFVARVETLEVEKW
FFRSICRRDAERQLLAPVNKAGAFLIRESETSKGAFSLSVKDVTTQGEVIKHYKIRSLDE
GGYYISPRSAFPTLQALVQHYSKKGDGLCQRLTHPCVSLAPQNPWGQDEWEIPRQSLKLV
RKLGSGQFGEVWMGYYKNNIKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVT
KEPIYIVTEYMARGCLLDFLKTDEGSRLSLSRLIDMSAQIAEGMAYIEQMNSIHRDLRAA
NILVSEALCCKIGDFGLARIIDNEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGIL
LMEIVTYGRVPYPGMSNPEVIRNLERGYRMPRPDSCPPELYNGIIAECWRSRPEERPTFE
FLQSVLEDFHTATEGQYELQP
Download sequence
Identical sequences Q08DU6
ENSBTAP00000006659 9913.ENSBTAP00000006659 NP_001069436.1.59421 NP_001069436.1.76553 XP_005209889.1.76553 XP_010806003.1.76553 ENSBTAP00000006659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]