SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006670 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006670
Domain Number 1 Region: 253-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-80
Family Protein kinases, catalytic subunit 0.0000000133
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-34
Family SH2 domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 73-145
Classification Level Classification E-value
Superfamily SH3-domain 1.77e-17
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006670   Gene: ENSBTAG00000005055   Transcript: ENSBTAT00000006670
Sequence length 527
Comment pep:known chromosome:UMD3.1:6:68405247:68449203:-1 gene:ENSBTAG00000005055 transcript:ENSBTAT00000006670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICFSDNTIQSIFCCCCCCSVQKRQVRTQISLSKDEELSEKYTQRRRPWFSDLPSKKQSN
RGHGQPSKRKPLPPLPPSEVSEEKIHVKALYDFLPREPYDLALKRAEEYLILEKYDPHWW
KARDRLGNEGLIPSNYVTENKPTNLEIYEWYHRNITRNQAERLLRQESKEGAFIVRDSRH
LGSYTISVFIRGCRDMEATIKHYQIKRNDSGQWYVAERHLFQSIPELIWYHQHNAAGLMS
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFVKQIGSGQFGVVYLGQWRAHVQVAIKA
INEGFMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQQKPLYIVTEFMEHGCLLNYLRERKG
KLSKEILLSVCQDICEGMEYLERNCFIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSSGAKFPVKWSPPEVFHFNRYSSKSDVWSFGVLMWEVFSEGKMPFENRSNLQVVEAIS
KGFRLYRPYLAPMCIYEVMYSCWHEKPKGRPTFAELLQVLTEIAETW
Download sequence
Identical sequences F1MQA9
ENSBTAP00000006670 ENSBTAP00000006670 9913.ENSBTAP00000006670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]