SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006711 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006711
Domain Number 1 Region: 431-770
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.32e-53
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 4-91,156-183
Classification Level Classification E-value
Superfamily EF-hand 5.1e-37
Family EF-hand modules in multidomain proteins 0.0071
Further Details:      
 
Domain Number 3 Region: 159-265
Classification Level Classification E-value
Superfamily EF-hand 6.08e-19
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 4 Region: 245-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 
Domain Number 5 Region: 327-384
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006711   Gene: ENSBTAG00000005091   Transcript: ENSBTAT00000006711
Sequence length 790
Comment pep:known_by_projection chromosome:UMD3.1:1:81514492:81687453:1 gene:ENSBTAG00000005091 transcript:ENSBTAT00000006711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDRWVSLTPEEFGQLQKYAEYSSKKIKYVLAEFNEGGSLKQYGPHEPISYDVFKLFMK
AYLEVDLPQPLSTHLFLAFSQKPRQKTPEHPKEGASNSEASGADSDIQNADNAAKADEAC
APDMETKITEKQVPAKNQAAATPVGNLVAPSSGSESPIVYLKDVVCYLSLLESGRPQDKL
EFMFRLYDSDENGLLDQAEMDRIVSQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLEEWVHGGMTTIPLLVLLGMDDSGSKGDGKHAWTLKHFKKPTYCNFCHVMLMGVRKQGL
CCIYCKYTVHERCVSKNIPACIKTNSKTKRGGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPDGKSDGSVSAKGEL
VMQYKIIPIPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFR
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYNIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSSIFLEGIAILNI
PSMYGGTNLWGETKKNRAVIRESRKVITDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGRRLAQCSSVSIRTNKLLPQVDGEPWMQPPCSIKITHKNQAPMMMGPPQKSSFF
SLRRKSRSKD
Download sequence
Identical sequences E1B9E4
ENSBTAP00000006711 ENSBTAP00000006711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]