SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006806 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006806
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily EF-hand 1.35e-25
Family S100 proteins 0.0000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006806   Gene: ENSBTAG00000005163   Transcript: ENSBTAT00000006806
Sequence length 94
Comment pep:known chromosome:UMD3.1:3:16812602:16816399:-1 gene:ENSBTAG00000005163 transcript:ENSBTAT00000006806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Download sequence
Identical sequences A0A212CFH8 A0A286XNC8 I3LX39 K7GQ50 M3XA34 P02639
ENSBTAP00000006806 NP_001092512.1.59421 NP_001092512.1.76553 XP_003475599.1.53824 XP_003999822.1.62641 XP_004002578.1.66739 XP_004284756.1.21590 XP_004403085.1.74151 XP_004403086.1.74151 XP_004780436.1.14098 XP_005006176.1.53824 XP_005203778.1.76553 XP_005331320.1.77405 XP_005331321.1.77405 XP_005411483.1.28644 XP_005975063.1.78601 XP_006039722.1.26621 XP_006748157.1.47382 XP_006748158.1.47382 XP_006748159.1.47382 XP_006748160.1.47382 XP_007088013.1.5354 XP_007130316.1.24612 XP_007130317.1.24612 XP_007178622.1.59432 XP_007178623.1.59432 XP_007464439.1.90284 XP_007946770.1.48129 XP_010801217.1.76553 XP_010836708.1.44457 XP_010836709.1.44457 XP_010836710.1.44457 XP_011227341.1.58354 XP_011289575.1.62641 XP_011987549.1.54773 XP_011987550.1.54773 XP_012037322.1.66739 XP_012037329.1.66739 XP_012418750.1.74151 XP_012418751.1.74151 XP_012905336.1.14098 XP_014338534.1.15283 XP_014940986.1.86478 XP_014940987.1.86478 XP_014962293.1.54773 XP_015395652.1.5354 XP_019286913.1.44245 XP_019286914.1.44245 XP_019810679.1.53367 XP_019810685.1.53367 XP_019810781.1.53367 XP_019810790.1.53367 XP_020746456.1.74333 XP_020746457.1.74333 XP_020746458.1.74333 XP_020746459.1.74333 XP_020945467.1.46622 XP_021537894.1.83697 ENSFCAP00000023487 9913.ENSBTAP00000006806 9913.ENSBTAP00000044226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]