SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006807 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006807
Domain Number 1 Region: 6-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-72
Family Eukaryotic proteases 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006807   Gene: ENSBTAG00000005164   Transcript: ENSBTAT00000006807
Sequence length 264
Comment pep:known chromosome:UMD3.1:20:24097290:24107687:-1 gene:ENSBTAG00000005164 transcript:ENSBTAT00000006807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFSSFFLCFLLAGTYMTPECFNMEIIGGREVSPHSRPFMASLQYGGDHICGGVLIHPQ
WVLTAAHCHLRFAKSQSSKVVLGAHSLSKNEASKQTFEIKKFIRFPGFALAPKSNDIMLV
KLHTAAILNRHVQLLHPRAKNDIKAGTKCQVVGWGATDPEGLSLSDTLREVTVTVISRKT
CNSRDYYNHSPVITRTMLCAGDARGQKDSCQGDSGGPLVCKGAFHALVSGGPKCGDAKKP
GIYILLTRKFQAWIKSNLAPSHAD
Download sequence
Identical sequences E1B7C7 L8J0R2
ENSBTAP00000006807 NP_001192888.1.59421 NP_001192888.1.76553 XP_005887433.1.15283 ENSBTAP00000006807 9913.ENSBTAP00000006807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]