SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006948 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006948
Domain Number 1 Region: 84-223,301-568
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-110
Family Myotubularin-like phosphatases 0.00000536
Further Details:      
 
Domain Number 2 Region: 626-826
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-30
Family Pleckstrin-homology domain (PH domain) 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006948   Gene: ENSBTAG00000043981   Transcript: ENSBTAT00000006948
Sequence length 829
Comment pep:known chromosome:UMD3.1:15:43413545:43480821:1 gene:ENSBTAG00000043981 transcript:ENSBTAT00000006948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APQIISPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKRRTGTIVEERVSRPGWNE
DDDVSVSDDSELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSKPEYFRI
TASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWRNSRSSTLLLRSGGF
HGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYLQALLSAVSVHQKLSGNNPLTVRPAL
ALSPGVWASLRSSTRLISSPTSFIDVGARLAGKDHSTSFSNSTYLQNQLLKRQATLYIFG
EKSQLRNFKLEFALNCEFVPVEYHDIRQVKASFKKLMRACVPSAIPTDSEVTFLRALGDS
EWFPQLHRILQLAVVVSEVLENGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFRM
LVEKEWLSFGHKFSQRSSLTLSCQGSGFTPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFL
AFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKKGICIWECIDRMHKRSPIFFNYLY
SPVEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKQLPSEDSELAGGARPQSQ
RRTVWPCYDDVSCAQPDALTILVEEIERLEHKLNQTPEKWQQLWERVNVDLKEEPRADHP
QRYPSGSPGTVSTNLPFYQKRPQLHLPDSNLAEEQNTGVSPSNGVDRRAATLYSQYTPKN
DENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPA
GPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDRIQSCISDA
Download sequence
Identical sequences F1ML65
ENSBTAP00000006948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]