SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007228 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007228
Domain Number 1 Region: 122-296,385-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.06e-42
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007228   Gene: ENSBTAG00000005498   Transcript: ENSBTAT00000007228
Sequence length 572
Comment pep:known chromosome:UMD3.1:14:16723393:16745626:-1 gene:ENSBTAG00000005498 transcript:ENSBTAT00000007228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVSLANKELLLCVLVFLSLGLVLSYRYRSGALLGRRQSGSQ
LAGFSYILSALPFIGFFWAKSPAGSENKEKLGSRRCKKGTSISETTLIGTAASTLTSSQN
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRILGEFLQPGGYYVLKDLGLED
TVEGIDAQVVNGYIIHDQESKTEVQIPFPLSENNHVQSGRAFHHGRFIMRLRKAAMAEPN
AKFIEGTVLQLLEEDDAVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKNLISNKVSI
SSHFVGFLMENAPQFKANHAELILANPSPVLIYQISPNETRVLVDVRGDMPRNLREYMTE
NIYPQLPDHLKGPFLEASQNSRLRSMPASFLPSSPVNKRGVLLLGDAYNMRHPLTGGGMT
VVFNDIKLWRKLLKGIPDLYDDAAVFQAKKSFYWARKKSHSFVVNVLAQALYELFSATDD
SLHQLRKACFFYFKLGGKCVAGPVGLLSVLSPNPLVLIGHFFGVAVYATYFCFKSEPWIT
KPRAIFSSGAVLYRACSVIFPLIYSEMKYLVH
Download sequence
Identical sequences A5D9A8 L8HSH3
ENSBTAP00000007228 ENSBTAP00000007228 9913.ENSBTAP00000007228 NP_001091530.1.59421 NP_001091530.1.76553 XP_005909972.1.15283 XP_010837193.1.44457 XP_019829546.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]