SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007304 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007304
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 7.23e-44
Family Globins 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007304   Gene: ENSBTAG00000005556   Transcript: ENSBTAT00000007304
Sequence length 190
Comment pep:known_by_projection chromosome:UMD3.1:19:55846583:55855228:1 gene:ENSBTAG00000005556 transcript:ENSBTAT00000007304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKVSSVLSLVGKAHALKHKVE
PVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences E1BMU2 V5V1J4
NP_001193649.1.59421 NP_001193649.1.76553 XP_005908066.1.15283 XP_006045377.1.26621 ENSBTAP00000007304 ENSBTAP00000007304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]