SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007443 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007443
Domain Number 1 Region: 10-120,161-187
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 61-79,135-227
Classification Level Classification E-value
Superfamily SH3-domain 4e-25
Family SH3-domain 0.0000291
Further Details:      
 
Domain Number 3 Region: 209-300
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007443   Gene: ENSBTAG00000005665   Transcript: ENSBTAT00000007443
Sequence length 304
Comment pep:known_by_projection chromosome:UMD3.1:19:23139102:23159120:-1 gene:ENSBTAG00000005665 transcript:ENSBTAT00000007443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
Download sequence
Identical sequences A0A0S2Z3Q4 A0A212D8B2 A0A2J8SNR0 A0A2K5DUZ7 A0A2K5IL87 A0A2K5NLC2 A0A2K5RJG6 A0A2K5X7X9 A0A2K6D8Z1 A0A2K6JQF3 A0A2K6Q388 E1BQ32 G3QV45 G3T5V2 H9FQ57 K7D4Z8 L5JSJ1 L7RT18 P46108
ENSP00000300574 ENSBTAP00000007443 ENSLAFP00000008842 ENSGGOP00000006608 ENSP00000300574 ENSBTAP00000007443 9600.ENSPPYP00000008754 9606.ENSP00000300574 9913.ENSBTAP00000007443 ENSDNOP00000022689 ENSPCAP00000013271 NP_001179263.1.59421 NP_001179263.1.76553 NP_058431.2.87134 NP_058431.2.92137 XP_002808155.2.72884 XP_002826851.1.23681 XP_003416856.1.64505 XP_003816887.1.60992 XP_004058274.1.27298 XP_004267122.1.21590 XP_004483830.1.11602 XP_005349592.1.66349 XP_005582485.1.63531 XP_006079839.1.26621 XP_006214491.1.17985 XP_006925118.1.64745 XP_006977463.1.50099 XP_007183875.1.59432 XP_007454291.1.90284 XP_007935627.1.48129 XP_008007995.1.81039 XP_010371797.1.97406 XP_011358190.1.92234 XP_011722495.1.29376 XP_011811254.1.43180 XP_011912374.1.92194 XP_012303773.1.9421 XP_015994440.1.101085 XP_015994441.1.101085 XP_016786611.1.37143 XP_017397171.1.71028 XP_017720882.1.44346 XP_019782494.1.83887 XP_020765483.1.74333 XP_021490588.1.76796 ENSPCAP00000013271 gi|41327712|ref|NP_058431.2| ENSGGOP00000006608 HR4663 ENSP00000300574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]