SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007480 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007480
Domain Number 1 Region: 51-243
Classification Level Classification E-value
Superfamily Nudix 8.53e-34
Family MutT-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007480   Gene: ENSBTAG00000005695   Transcript: ENSBTAT00000007480
Sequence length 257
Comment pep:known chromosome:UMD3.1:17:35146244:35205444:1 gene:ENSBTAG00000005695 transcript:ENSBTAT00000007480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNTYQVPRRVSATYLPLSKPAVQKWRSEGRVAVWLHIPILQSRFIAPAASLGFCFHHTE
SDSSMLSLWLGDGPSRLPGYATHQVGVAGAVFDENTRKILVVQDRNKLKNMWKFPGGLSE
PGEDIGDTAVREVFEETGIKSEFRSLLSIRQQHTHPGAFGKSDMYIICRLKPYSFTINFC
QRECLKCEWMNLSDLVKTKNTTPITSRVARLLLYGYKEGFDKIDLTMEELPAVYTGLFYK
LYHKKLPDNYKTMTGMD
Download sequence
Identical sequences A7YY29
ENSBTAP00000007480 ENSBTAP00000007480 9913.ENSBTAP00000007480 NP_001099120.1.59421 NP_001099120.1.76553 XP_005217651.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]