SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007580 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007580
Domain Number 1 Region: 81-389,496-534
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.66e-62
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 370-476
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.1e-25
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007580   Gene: ENSBTAG00000005766   Transcript: ENSBTAT00000007580
Sequence length 586
Comment pep:known_by_projection chromosome:UMD3.1:18:56691667:56725849:-1 gene:ENSBTAG00000005766 transcript:ENSBTAT00000007580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDDDVRPGLTRKAMGTERACQSQPCTWRLLALVPVFLSLAASLDWQTAHIYDPFEKCMH
DPDYEQLLKVVTLGLNRTLNPRRVVVVGAGVAGLVAAKVLSDAGHKVTILEADSRIGGRI
LTYRDRKTGWIGELGAMRMPSSHRILHELCKSLGLNLTKFTQYDENTWTEVNEVKLRNYV
VEKMPEKLGYKLSPKEKGRSPEEIYQMALNRAIKDLRTLGCKKAMMKFERHTLLEYLLGE
GNLSQPAVRLLGDVMSKDGFFYLSFAEALRAHSCLSDRLRYSRIVGGWDLLPRALLSSLS
GPVLLHAPVVAIKQGTHEVKVHIKPSRRTRNLKSMMADVVLLTVSGPALQRIAFTPPLTR
RRQEAVRGLHYVPATKVFLSFRRPFWHDEHIEGGHSSTDRPSRVIFYPAPGDGALLLASY
TWSDAAAPFAGRSLAESLRLALDDVAALHGPIAYRLWDGTGIIKRWAEDPHSQGGFVVQP
PTLFQTDKDEGREFDWSVPYGRIYFAGEHTAYPHGWVETAVKSALRAAILINSRISGSGS
SSSLKEPRIVNKVGHGHLTPSHHQHHHHHHRCPFESGQGTHSPASH
Download sequence
Identical sequences F1N191
ENSBTAP00000007580 ENSBTAP00000007580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]