SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007636 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007636
Domain Number 1 Region: 203-262,405-440
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000116
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 2 Region: 307-440
Classification Level Classification E-value
Superfamily EF-hand 0.00000000222
Family Penta-EF-hand proteins 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007636   Gene: ENSBTAG00000005807   Transcript: ENSBTAT00000007636
Sequence length 478
Comment pep:known chromosome:UMD3.1:28:28562368:28777941:-1 gene:ENSBTAG00000005807 transcript:ENSBTAT00000007636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLNSLSALAELAVGSRWYHGGSQPTQIRRRLMMVAFLGASAVTASTGLLWKRALAESP
PSANNIKSELGDKGKSKEEGEDCNAEKKAAGVCLEPYPEEKKKKRSGFRDRKVMEYENRI
RAYSTPDKIFRYFATLKVISEHGESEVFMTPQDFVRSITPNEKQPEHLGLDQYTIKRFDG
KKIAQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEV
DMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLE
FQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQKQLKKHFKEGKG
LTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFA
LFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ
Download sequence
Identical sequences Q0IIL1
ENSBTAP00000007636 ENSBTAP00000007636 NP_001068806.1.59421 NP_001068806.1.76553 XP_005888751.1.15283 XP_010850565.1.44457 XP_019809510.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]