SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007743 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007743
Domain Number 1 Region: 341-596
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-72
Family Protein kinases, catalytic subunit 0.000000000338
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-31
Family SH2 domain 0.000000475
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-29
Family SH2 domain 0.000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007743   Gene: ENSBTAG00000005892   Transcript: ENSBTAT00000007743
Sequence length 617
Comment pep:known_by_projection chromosome:UMD3.1:11:3016325:3056118:1 gene:ENSBTAG00000005892 transcript:ENSBTAT00000007743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHEVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDNLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEPGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASSGAAAPTLPAHPSTFTQPQRRIDTLNSDGYTPEPARLVSS
EKPRTMPMDTSVYESPYSDPEELKNKKLFLKRENLLMADIELGCGNFGSVRQGVYRMRKK
QIDVAIKVLKQSTEKADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPL
HKFLVGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGL
SKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPYKK
MKGPEVMAFIEQGKRMECPPECPPEMYKLMSDCWTYKWEDRPDFAAVEQRMRTYYYSLAT
KAEEPAACGNGVEAACP
Download sequence
Identical sequences E1BMP9
ENSBTAP00000007743 9913.ENSBTAP00000007743 NP_001179946.1.59421 NP_001179946.1.76553 XP_005891686.1.15283 XP_010827908.1.44457 XP_019825298.1.53367 ENSBTAP00000007743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]