SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007760 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007760
Domain Number 1 Region: 201-341
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.05e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0064
Further Details:      
 
Domain Number 2 Region: 86-199
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.4e-26
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000007760
Domain Number - Region: 424-474
Classification Level Classification E-value
Superfamily EF-hand 0.0551
Family Calbindin D9K 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007760   Gene: ENSBTAG00000005908   Transcript: ENSBTAT00000007760
Sequence length 871
Comment pep:known chromosome:UMD3.1:25:38526452:38551441:-1 gene:ENSBTAG00000005908 transcript:ENSBTAT00000007760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKEKKKADKKGDKSARSPSSPSDYPEFAKQDGNAPRQDASPSAAPALDVQPKDPGVKRE
VKSESLPNEDTTQYEEPVLTKLIVESYEGEKVRGLYEGEGFAIFQGGCTYQGMFSEGLMH
GQGTYIWADGLKYEGDFVKNIPMNHGVFTWPDGSTYEGEVVGGMRHGFGMFKCSTQPVSY
IGHWCHGKRHGKGSIYYNQEGTSWYEGDWIHNIRKGWGIRCYKSGNIYEGQWENNVRHGE
GRMRWLTTNEEYTGQWKHGVQNGLGTHTWFLKRIPYSQYPLRNEYVGEFVNGYRHGHGKF
YYASGAMYEGEWVSNKKHGMGRLTFKNGRVYDGPFSKDHMVAFPNLEGEVMSYPDSTSEC
AFGCQWCRPSASAEIMRKLDGNESNSLLGSSLELDLSLLLKMYPERDQSEEKKQVEYAIL
RNITELRRIYNFYSSLGCDRSLDNTFLMTKLHFWRFLKDCKFHHHNITLADMDRVLGANN
NIPVEEIHSPFTTLLLRTFLNYLLQLAYHIHHKEYQDRSPSLFLCFKKLMNENIRPNACR
VKGRLFCEAQRTLYSMTYVDKCWEIYTAHCRPNAAPPHELTMSTRHFLWMLRSFKMINKE
LTATKFVEVIAEDNPSMYDGIDSNFELELVFLEFFEALLSFALICVPEPPTKFCSDFPND
DLSVNKAGSTYPVTAQNTQNRSPSAVASQESDIQFSSTKSSSSKLGVLVDISKIRKSEPK
IKKSVSDGKTSKVNFKSAGKGLTFLLSQSGKKEKHKDEQKEKFNIWISNMYVFFVNTLFQ
AHKHEETLKEKVKENRLHNEAMALQRKMENEELEARLNSLREEEAKRQDYEVDITVIKEP
VDAPSSSFTPSPPKEDTVVSSKSITSKKKKK
Download sequence
Identical sequences F1N5C9
ENSBTAP00000007760 NP_001160086.1.59421 NP_001160086.1.76553 XP_005225128.1.76553 ENSBTAP00000007760 9913.ENSBTAP00000007760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]