SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007874 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007874
Domain Number 1 Region: 30-197
Classification Level Classification E-value
Superfamily L domain-like 1.13e-31
Family Internalin LRR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007874   Gene: ENSBTAG00000005996   Transcript: ENSBTAT00000007874
Sequence length 255
Comment pep:known chromosome:UMD3.1:28:43603727:43620831:-1 gene:ENSBTAG00000005996 transcript:ENSBTAT00000007874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGAKGPKGKKITLAVAKNCIKITFDGKKRLDLSKMGITTFPKCILRLTDVDELDLSRN
LIKKIPDAISKFQNLRWLDLHSNYIDKLPETIGQMTSLLYLNVSNNRLTTNGLPVELNQL
KNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLSNIPNSISKLPKLKKLNTKRNPFP
KAESSDMFMDSIRRLDNLHLVEEKDLCGTCLKKCQQARDKLNKIKSMATTIPRKAIFSTL
VSPNSMAKESQEDWR
Download sequence
Identical sequences Q32KZ3
ENSBTAP00000007874 9913.ENSBTAP00000007874 NP_001070526.1.59421 NP_001070526.1.76553 ENSBTAP00000007874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]