SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007881 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007881
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily PH domain-like 5.71e-26
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000151
Family SH2 domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007881   Gene: ENSBTAG00000006001   Transcript: ENSBTAT00000007881
Sequence length 382
Comment pep:known chromosome:UMD3.1:7:20966851:20978542:1 gene:ENSBTAG00000006001 transcript:ENSBTAT00000007881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALALSPPRVPKPKSALPLHYYESFLEKKGPRDRDYKKFWAGLQGLTLYFYNSNRDTKHV
EKLDLGGFVKLTDEAPWGNSHDPSTHFCLVLRNQEIKFKVESLESREMWKGFILTVVELR
VPSNLTLLPGHLYMMSEALAKEEARRVLEMPSCFLKVSRLEAQLLLERYPECGNLLLRPS
GDGTDGVSVTTLQTLNGTPMVRHYKVKREGAKYVIDVEEPFSCTSLEAVVNYFVSYSNKA
LVPFLLDEDYDKVIGPAPPKGGPKQLPPTSITPAPSLDKLPPLPDQDNNYVIPIGDTPAA
SYMNEDVPSPSQLVVPKPRRLVKLQAKLPKPPTVPKSEPKGLNSGPAKKLAASSAQAFSP
TTGLADVTAELEEKLQKRRALE
Download sequence
Identical sequences Q3ZCE1
ENSBTAP00000007881 ENSBTAP00000007881 NP_001029418.1.59421 NP_001029418.1.76553 XP_019819998.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]