SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007892 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007892
Domain Number 1 Region: 1432-1571
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.65e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000227
Further Details:      
 
Domain Number 2 Region: 241-331
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000686
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007892   Gene: ENSBTAG00000006008   Transcript: ENSBTAT00000007892
Sequence length 1576
Comment pep:known_by_projection chromosome:UMD3.1:11:103446831:103489544:-1 gene:ENSBTAG00000006008 transcript:ENSBTAT00000007892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGCPAGEGWRRMEAAPDGAVDIVPLDRYDPARAKIAANLQWICAKAYGRDDIPEDL
RDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVASLQGHQSVIQALSRKGIY
VMESDDTPVTEPDLSHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWVNKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREQLCARQPPHFPL
LEDLMRDGSHGAALLAVVHYYCPGQLKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKC
FYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKSVSYPKSSRP
PVPISNATKRSFLGSPAAASPADLQLGEPEPPPAAGDFSLPSSLFRGKGASAFSPSHPLL
PLRQKQQKTVQGEDPPDQRHRSNSLTRADSQPRGAAIAWTEKKNRPVSQPAPFALHHTAS
CDMDPGGGDSVSLARSISKDSLASSVVHLTPQNQPQPAALRTDGRSLLSNVDIEDEDEEL
LAIVRTDVARQGGDPGPMAGARSPHRLADAFESKTDSFFLEPLMPAVLRPAKEKQVVTKE
DECGEGRPRAFTSRRSGDGHQPLGRKKAPSSHVARDLNRTFSPISCSEMSAGFEAVPAEV
GPQVAGDTHGGSLAGSSFDPSSQGQSADGFFLHVGRADKDAEGRLYMSCARSPGALSPDT
WAVLRQDSDSDVADLDEAEQDFAGEEHPAVRAGYGGEEESAKLQEDLKVKEHDDKDDASG
RSSPCLSTVSQTSSASMASGSAKMTSFAERKLQRLNSCETKSSASSSQKTTPDASESCPA
PLTTWKQRREQSPSRPGGDHASLLASELLQLHMQLEEKRRAIEAQKKKVEALSARQRLQL
GKAAFLHVVKKGRADATQQPLKVGSLAGEHAQHNGDDFLGKEEGRGALLGSPDVDGEGLA
LVQPHKARDPASLPELEHGKALSAVLLEDTEGVDVGECDLSIEKLNETISTLQQAILRIS
QQQEQLLLKSPTLPSPGPRNGAQDPKAKAAIHFVEPLSPTALTGHRKPPRLGQGRNARSG
RPAELKVPKERQQGSSRSKTPTPGLETAPHSRSFPPRTPPEPGWDGPSEPGSEASEKCVF
DSYRLHDESNQRTLVLSSSRDANVLSEQGGFREGLEGSAKEAGLSTLPAPGKENVPLDEP
PRSKASLIEVDLSDLKAPDEDGETEGRDSSVDLGSEGDQKPGVGFFFKDEQKADDELAKK
RAAFLLKQQRKAEEARVRRQQLEAEVELKRDEARRKAEEDRIRKEEEKARRELIKQEYLR
RKQQQILEEQGLGKPKTRPRKPRPKSVHREEPGSDLGPKSASPPDNLSRAQSGSSLSLAS
AATTEPESVHSGGTPSQRVESLEALPVLSRNPSRSTDRDWETASAASSLASVAEYTGPKL
FKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRAL
YCYYPDTEEICKLTGTGPKSIAKKMIDKLYKYSSDRKQFSLIPAKTMSVSVDALTIHNHL
WQPKRPSAPKKTQTRK
Download sequence
Identical sequences F1MYW2
ENSBTAP00000007892 ENSBTAP00000007892 NP_001179025.1.59421 NP_001179025.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]