SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007972 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007972
Domain Number 1 Region: 23-186
Classification Level Classification E-value
Superfamily EF-hand 4.23e-31
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007972   Gene: ENSBTAG00000006069   Transcript: ENSBTAT00000007972
Sequence length 189
Comment pep:known chromosome:UMD3.1:7:19691006:19692540:-1 gene:ENSBTAG00000006069 transcript:ENSBTAT00000007972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVDTTMEKLRAQCLSRGASGIQGVARFFRRLDQDGSRSLDVRELQRGLAELGLVLDTA
EMEGVCRRWDRDGSGTLDLEEFLRALRPPMSQAREAVVTAAFAKLDRSGDGVVTVDDLRG
VYSGRTHPKVRSGEWTEEQVLRHFLDNFDSSEKDGQVTLAEFQDYYSGVSASMDTDEEFV
AMMTSAWRL
Download sequence
Identical sequences Q0VCC0
NP_001069892.1.59421 NP_001069892.1.76553 XP_019819921.1.53367 ENSBTAP00000007972 ENSBTAP00000007972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]