SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008207 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008207
Domain Number 1 Region: 17-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1328-1440
Classification Level Classification E-value
Superfamily E set domains 6.41e-36
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1531-1639
Classification Level Classification E-value
Superfamily E set domains 1.47e-33
Family Filamin repeat (rod domain) 0.00000214
Further Details:      
 
Domain Number 4 Region: 452-570
Classification Level Classification E-value
Superfamily E set domains 1.67e-31
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 5 Region: 1853-1947
Classification Level Classification E-value
Superfamily E set domains 8.67e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 6 Region: 668-775
Classification Level Classification E-value
Superfamily E set domains 2.04e-30
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 7 Region: 2037-2130
Classification Level Classification E-value
Superfamily E set domains 2.5e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 8 Region: 846-967
Classification Level Classification E-value
Superfamily E set domains 2.8e-30
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 9 Region: 1442-1554
Classification Level Classification E-value
Superfamily E set domains 3.34e-30
Family Filamin repeat (rod domain) 0.0000198
Further Details:      
 
Domain Number 10 Region: 1143-1247
Classification Level Classification E-value
Superfamily E set domains 4.34e-30
Family Filamin repeat (rod domain) 0.0000515
Further Details:      
 
Domain Number 11 Region: 1239-1350
Classification Level Classification E-value
Superfamily E set domains 5e-30
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 12 Region: 1061-1152
Classification Level Classification E-value
Superfamily E set domains 7.34e-30
Family Filamin repeat (rod domain) 0.00000971
Further Details:      
 
Domain Number 13 Region: 2310-2401
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 14 Region: 2632-2722
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000328
Further Details:      
 
Domain Number 15 Region: 560-661
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 16 Region: 764-867
Classification Level Classification E-value
Superfamily E set domains 1.03e-25
Family Filamin repeat (rod domain) 0.00081
Further Details:      
 
Domain Number 17 Region: 274-370
Classification Level Classification E-value
Superfamily E set domains 1.53e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 18 Region: 374-474
Classification Level Classification E-value
Superfamily E set domains 2.54e-25
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 19 Region: 1628-1740
Classification Level Classification E-value
Superfamily E set domains 2.6e-25
Family Filamin repeat (rod domain) 0.0000633
Further Details:      
 
Domain Number 20 Region: 2501-2593
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 21 Region: 2408-2498
Classification Level Classification E-value
Superfamily E set domains 2.54e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 955-1055
Classification Level Classification E-value
Superfamily E set domains 1.8e-22
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 23 Region: 2243-2324
Classification Level Classification E-value
Superfamily E set domains 6.27e-20
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1955-2051
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000946
Further Details:      
 
Domain Number 25 Region: 1789-1869
Classification Level Classification E-value
Superfamily E set domains 6.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008207   Gene: ENSBTAG00000006253   Transcript: ENSBTAT00000008207
Sequence length 2723
Comment pep:known_by_projection chromosome:UMD3.1:4:93609408:93636607:1 gene:ENSBTAG00000006253 transcript:ENSBTAT00000008207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNNSGYSEAPGFGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGIGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPRGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGIQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGAHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSLSSPFKIKVLPAHDASKVRASGPGLNASGIPA
SLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKY
GGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKG
KVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACE
AMPRVEEPPDVPQLHRPSAYPTHWATEEPVVPAEPMESMLRPFNLVIPFTVQKGELTGEV
RMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHV
SAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTA
PGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIR
APSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDAS
KVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCP
TEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPG
NWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVF
GDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFVPQE
MGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREA
GAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVA
SLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSD
KHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGV
SSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQH
IVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRG
PGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKG
DYILIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences E1BE25
ENSBTAP00000008207 ENSBTAP00000008207 9913.ENSBTAP00000008207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]