SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008311 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008311
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.4e-80
Family STAT DNA-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 3.53e-27
Family STAT 0.0038
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.09e-26
Family Transcription factor STAT-4 N-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008311   Gene: ENSBTAG00000006335   Transcript: ENSBTAT00000008311
Sequence length 847
Comment pep:known_by_projection chromosome:UMD3.1:5:56658077:56670842:1 gene:ENSBTAG00000006335 transcript:ENSBTAT00000008311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLGDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQASAGEQGEGNTILQHISTLETIYQRDPLKLVATCRHILQGEKKAVMEQFHHLPMS
FHWKQEELKFNTVLRRLQHRAGETRLLREALQPGAEAGQVSLHSLIETPTNGTGPSEALV
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELDPKTRAALISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSMPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSLTLGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSIEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
PQMPTMVPSYDLGMAPDSSMNLQLGPDMVPQVYPPRSHSIPSYPALPREESVNMLPAFQE
PHLPMPPNLSQMSLPFDQPHPQGLLPCPPQDHAVSSPEPLLCSDVTMAEDSCLNQPVGGF
PQGTWVREDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGPQPLLQPSPYGQSGISMSHLD
LRANPSW
Download sequence
Identical sequences F1MGJ4
NP_001192430.1.59421 NP_001192430.1.76553 XP_005206571.1.76553 XP_019816538.1.53367 9913.ENSBTAP00000008311 ENSBTAP00000008311 ENSBTAP00000008311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]