SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008335 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008335
Domain Number 1 Region: 136-400
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.48e-58
Family Eukaryotic proteases 0.0000719
Further Details:      
 
Domain Number 2 Region: 87-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000612
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 30-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000584
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008335   Gene: ENSBTAG00000006354   Transcript: ENSBTAT00000008335
Sequence length 401
Comment pep:known chromosome:UMD3.1:18:39173135:39179293:-1 gene:ENSBTAG00000006354 transcript:ENSBTAT00000008335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALQAVVTLLLCGQLLAVETGSEATADSCPKAPEIANSHVEYSVRYQCDKYYKLHAGNG
VYTFNNKQWINKDIGQQLPECEEDDSCPEPPKIENGYVEYLVRYQCKPYYTLRTCGDGVY
TFNSKKQWINKNIGQKLPECEAVCGKPKHPVDQVQRIIGGSLDAKGSFPWQAKMVSQHNL
ISGATLINERWLLTTAKNLYLGHSSDKKAKDITPTLRLYVGKNQLVEVEKVVLHPDHSKV
DIGLIKLRQKVPVNDKVMPICLPSKDYVKVGRVGYVSGWGRNENFNFTEHLKYVMLPVAD
QDKCVKHYEGIDAPKNKTAKSPVGVQPILNENTFCVGLSKYQDDTCYGDAGSAFVVHDKE
DDTWYAAGILSFDKSCAVAEYGVYVKVTSILDWVRKTIANN
Download sequence
Identical sequences G3X6K8
ENSBTAP00000008335 ENSBTAP00000008335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]