SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008386 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008386
Domain Number 1 Region: 4-553
Classification Level Classification E-value
Superfamily SIS domain 1.41e-234
Family Phosphoglucose isomerase, PGI 0.0000000000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008386   Gene: ENSBTAG00000006396   Transcript: ENSBTAT00000008386
Sequence length 557
Comment pep:known chromosome:UMD3.1:18:44979578:45007642:1 gene:ENSBTAG00000006396 transcript:ENSBTAT00000008386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTQNPQFKKLKTWYEQHGSDLNLRRLFEGDRDRFNRFSLNLNTNHGHILVDYSKNLV
TETVMQMLVDVAKSRGVEAARERMFTGEKINFTEDRAVLHVALRNRSNAPILVDGKDVMP
EVNRVLEKMKSFCQRVRSGEWKGYSGKAITDVINIGIGGSDLGPLMVTEALKPYSSEGPR
VWFVSNIDGTHIAKTLATLNPESSLFIIASKTFTTQETITNAETAKEWFLLSAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVNYQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQSQHPIRNGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGRSPEDFEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDS
STNGLINFIKQEREARS
Download sequence
Identical sequences Q3ZBD7
ENSBTAP00000008386 ENSBTAP00000008386 XP_010847256.1.44457 XP_019834197.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]