SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008640 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008640
Domain Number 1 Region: 6-82
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000223
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008640
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008640   Gene: ENSBTAG00000006578   Transcript: ENSBTAT00000008640
Sequence length 236
Comment pep:known chromosome:UMD3.1:13:51880158:51883728:1 gene:ENSBTAG00000006578 transcript:ENSBTAT00000008640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWSHLNRKVLNKLNFSVPEDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQ
GIGSLQELAPQDGTDYMDVGLSQKARGEGVPDPQGRGQLREGRLPVPRPPGDSQALQSDP
SFILQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR
Download sequence
Identical sequences Q58DA1
9913.ENSBTAP00000008640 ENSBTAP00000008640 ENSBTAP00000008640 NP_001029594.1.59421 NP_001029594.1.76553 XP_010834782.1.44457 XP_019827485.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]