SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008652 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008652
Domain Number 1 Region: 15-184
Classification Level Classification E-value
Superfamily Nudix 0.000000000000268
Family MutT-like 0.0000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008652   Gene: ENSBTAG00000006590   Transcript: ENSBTAT00000008652
Sequence length 211
Comment pep:known chromosome:UMD3.1:25:3802677:3810372:1 gene:ENSBTAG00000006590 transcript:ENSBTAT00000008652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAVPELKRISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLE
QLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFISTAKYQLLFALKVL
NMMPEEKLAEALAAATEKQKKALEKLLPSSS
Download sequence
Identical sequences Q3MHX9
NP_001029698.1.59421 NP_001029698.1.76553 XP_006054955.1.26621 XP_012011519.1.54773 XP_012011520.1.54773 XP_017895755.1.57651 ENSBTAP00000008652 ENSBTAP00000008652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]